MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) [2F6]

Clear

Summary

Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.

Product Properties & Targets

Host
Species Reactivity
Research Areas
Isotype
Cellular Localization
Gene Name
MAP3K1
Mol. Weight of Antigen
195kDa (intact); 80kDa (cleaved)
Immunogen
Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)

Database Links

Entrez Gene ID
Unigene
SwissProt

Additional Information

Clone
2F6
Human Gene Symbol
MAP3K1
Chromosome Location
5q11.2

Known Applications & Suggested Dilutions

  • Western Blot (1-2ug/ml)
  • Immunohistochemistry (Formalin-fixed) (1-2ug/ml for 30 minutes at RT)(Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris Buffer with 1mM EDTA, pH 9.0, for 45 min at 95&degC followed by cooling at RT for 20 minutes)Optimal dilution for a specific application should be determined.

Key References

  • Guan, K.L. 1994. The mitogen activated protein kinase signal transduction pathway: from the cell surface to the nucleus. Cell. Signal. 6: 581-589.

Storage & Stability

Antibody with azide - store at 2 to 8°C. Antibody without azide - store at -20 to -80°C. Antibody is stable for 24 months. Non-hazardous. No MSDS required.

Limitations

This antibody is available for research use only and is not approved for use in diagnosis.

Supplied as

200ug/ml of Ab Purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.

Warranty

There are no warranties, expressed or implied, which extend beyond this description. Company is not liable for any personal injury or economic loss resulting from this product.

Recombinant mouse monoclonal antibodies and recombinant rabbit monoclonals to support your research

Shop Primary Antibodies