GDF9 (Growth Differentiation Factor 9) Antibody [GDF9/4261]

In Stock
Catalog Number Formulation Size Price
2661-MSM1-P0
Purified Ab with BSA and Azide at 200ug/ml
20ug
$259.00
2661-MSM1-P1
Purified Ab with BSA and Azide at 200ug/ml
100ug
$559.00
2661-MSM1-P1ABX
Purified Ab WITHOUT BSA and Azide at 1.0mg/ml
100ug
$559.00
Flat Rate Domestic: $95 | Orders outside the US - Contact Us for Order Information | Ships next business day

Applications & Dilutions

Applications Tested Dillution Protocol Note
Immunohistochemistry (IHC)
1-2ug/ml
30 min at RT. Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 45 min at 95°C followed by cooling at RT for 20 minutes
Western Blot (WB)
2-4ug/ml

Summary

GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.

Product Properties & Targets

Antibody Type
Host
Mouse
Species Reactivity
Research Areas
Isotype / Light Chain
IgG1 /
Cellular Localization
Secreted
Gene Name
Positive Control
Human ovary.
Immunogen
Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9.
Alternate Names
Growth/differentiation factor 9, Growth/differentiation factor 9, GDF-9, GDF9

Database Links

Entrez Gene ID
SwissProt

Additional Information

Clone
GDF9/4261
Chromosome Location
5q31.1
Mol. Weight of Antigen
51kDa

Functions

  • Required for ovarian folliculogenesis. Promotes primordial follicle development. Stimulates granulosa cell proliferation. Promotes cell transition from G0/G1 to S and G2/M phases, through an increase of CCND1 and CCNE1 expression, and RB1 phosphorylation. It regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells. Attenuates the suppressive effects of activin A on STAR expression and progesterone production by increasing the expression of inhibin B. It suppresses FST and FSTL3 production in granulosa-lutein cells.

Key References

  • Gilchrist, R.B., et al. (2004) Immunoneutralization of Growth Differentiation Factor 9 Reveals It Partially Accounts for Mouse Oocyte Mitogenic Activity. Biol Reprod; 71 (3): 732-739.

Storage & Stability

Antibody with azide - store at 2 to 8 °C. Antibody without azide - store at -20 to -80 °C. Antibody is stable for 24 months. Non-hazardous. No MSDS required.

Limitations

This antibody is available for research use only and is not approved for use in diagnosis.

Supplied as

200ug/ml of Ab purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.

Warranty

There are no warranties, expressed or implied, which extend beyond this description. Company is not liable for any personal injury or economic loss resulting from this product.

Reviews

There are no reviews yet.

Be the first to review “GDF9 (Growth Differentiation Factor 9) Antibody”

Your email address will not be published. Required fields are marked *

PARTNERSHIP OPPORTUNITIES

NeoBiotechnologies holds Exclusive rights to 10,000 recombinant and hybridoma antibody products, available for Licensing or Collaboration.

LETS TALK