Home >> Antibodies >> GDF9 (Growth Differentiation Factor 9)

GDF9 (Growth Differentiation Factor 9)

Mouse Monoclonal Antibody [Clone GDF9/4261]

Printable

Key References

Bioinformatics

Catalog #

Size

20 ug

100 ug

Price (USD)

219.00

499.00

Formulation

Purified Ab with BSA and Azide at 200ug/ml

Purified Ab WITHOUT BSA and Azide at 1.0mg/ml

Performance Guarantee

Catalog No

Size

20 ug

100 ug

Formulation

Purified Ab with BSA and Azide at 200ug/ml

Purified Ab WITHOUT BSA and Azide at 1.0mg/ml

Price (USD)

219.00

499.00

Printable

Key References

Bioinformatics

SDS-PAGE Analysis Purified GDF9 Mouse Monoclonal Antibody (GDF9/4261) Confirmation of Integrity and Purity of Antibody.

Formalin-fixed, paraffin-embedded human ovary stained with GDF9 Mouse Monoclonal Antibody (GDF9/4261).

SDS-PAGE Analysis Purified GDF9 Mouse Monoclonal Antibody (GDF9/4261) Confirmation of Integrity and Purity of Antibody.

Formalin-fixed, paraffin-embedded human ovary stained with GDF9 Mouse Monoclonal Antibody (GDF9/4261).

Product Details

Synonyms

Growth/differentiation factor 9, GDF-9, GDF9

Positive Control

Human ovary.

Known Applications & Suggested Dilutions

ELISA, Western Blot, IHC-P More Details

ELISA (For coating, order antibody without BSA)
Western Blot (1-2ug/ml)
Immunohistochemistry (Formalin-fixed) (1-2ug/ml for 30 minutes at RT)
(Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 45 min at 95 °C followed by cooling at RT for 20 minutes)
Optimal dilution for a specific application should be determined.

Immunogen

Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9.

Cellular Localization

Cytoplasmic (secreted)

Species Reactivity

Human.

Host / Ig Isotype

Mouse / IgG1

Mol. Weight of Antigen

51kDa

Specificity & Comments

GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.