DOG-1 / ANO1 (Marker for Gastrointestinal Stromal Tumors) Antibody [DG1/447 + DOG-1.1]

Additional information

Catalog Number: 55107-MSM3
Reactivity:

Gene:

Host:

In Stock

Trial Size Available

Carrier-Free Available

In Stock
Catalog Number Formulation Size Price
55107-MSM3-P0
Purified Ab with BSA and Azide at 200ug/ml
20ug
$259.00
55107-MSM3-P1
Purified Ab with BSA and Azide at 200ug/ml
100ug
$559.00
55107-MSM3-P1ABX
Purified Ab WITHOUT BSA and Azide at 1.0mg/ml
100ug
$559.00
Flat Rate Domestic: $95 | Orders outside the US - Contact Us for Order Information | Ships next business day
  • IHC

Documents

Document Name
Datasheet Download Here
Material Safety Data Sheet Download Here

Applications & Dilutions

Applications Tested Dilutions Protocol Note
Immunohistochemistry (IHC) 1-2ug/ml IHC Protocol 30 min at RT. Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 45 min at 95°C followed by cooling at RT for 20 minutes

Product Properties

Antibody Type
Host
Mouse
Applications
Species Reactivity
Clone
DG1/447 + DOG-1.1
Isotype
IgG1
Light Chain
Kappa
Cellular Localization
Cell membrane, Cytoplasm
Gene Name
Positive Control
Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
Immunogen
Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).
Storage & Stability
Antibody with azide - store at 2 to 8°C. Antibody without azide - store at -20 to -80°C. Antibody is stable for 24 months. Non-hazardous. No MSDS required.
Supplied as
200ug/ml of Ab Purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.
Limitations
This antibody is available for research use only and is not approved for use in diagnosis.

Related Antibodies

Other Information

Functions
Key References
Warranty
There are no warranties, expressed or implied, which extend beyond this description. Company is not liable for any personal injury or economic loss resulting from this product.
Entrez Gene ID
SwissProt
Chromosome Location
11q13.3
Mol. Weight of Antigen
~114kDa
Alternate Names
Anoctamin-1, Discovered on gastrointestinal stromal tumors protein 1, Oral cancer overexpressed protein 2, Transmembrane protein 16A, Tumor-amplified and overexpressed sequence 2, Anoctamin 1; Calcium Activated Chloride Channel; Discovered On Gastrointestinal Stromal Tumors Protein 1; TAOS2; ORAOV2; TMEM16A

Summary

Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GIST’s), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GIST’s, including all c-kit negative GIST’s. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GIST’s is nearly identical: 94.4% vs. 94.7%.

Worry-Free Guarantee

Should a NeoBiotechnologies antibody not meet the experimental expectations outlined on our website or datasheet, please contact our Technical Support. We unconditionally guarantee our product.

Need Technical Help?

Our team of scientists are ready to help you with expert recommendations or technical assistance related to applications or product use.