Free Shipping in the U.S. for orders over $1000.  Shop Now>>

DOG-1 / ANO1 (Marker for Gastrointestinal Stromal Tumors) Antibody [DG1/447 + DOG-1.1]

In Stock
Catalog Number Formulation Size Price
55107-MSM3-P0
Purified Ab with BSA and Azide at 200ug/ml
20ug
$229.00
55107-MSM3-P1
Purified Ab with BSA and Azide at 200ug/ml
100ug
$519.00
55107-MSM3-P1ABX
Purified Ab WITHOUT BSA and Azide at 1.0mg/ml
100ug
$519.00
Flat Rate Domestic: $60 | Orders outside the US - Contact Us for Order Information | Ships next business day

Applications & Dilutions

Applications Tested Dillution Protocol Note
Immunohistochemistry (IHC)
1-2ug/ml
30 min at RT. Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 45 min at 95°C followed by cooling at RT for 20 minutes

Summary

Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GIST's), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GIST's, including all c-kit negative GIST's. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GIST's is nearly identical: 94.4% vs. 94.7%.

Product Properties & Targets

Antibody Type
Host
Mouse
Applications
Species Reactivity
Isotype / Light Chain
IgG1 / Kappa
Cellular Localization
Cell membrane, Cytoplasm
Gene Name
Positive Control
Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
Immunogen
Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).
Alternate Names
Anoctamin-1, Discovered on gastrointestinal stromal tumors protein 1, Oral cancer overexpressed protein 2, Transmembrane protein 16A, Tumor-amplified and overexpressed sequence 2, Anoctamin 1; Calcium Activated Chloride Channel; Discovered On Gastrointestinal Stromal Tumors Protein 1; TAOS2; ORAOV2; TMEM16A

Database Links

Entrez Gene ID
SwissProt

Additional Information

Clone
DG1/447 + DOG-1.1
Chromosome Location
11q13.3
Mol. Weight of Antigen
~114kDa

Functions

  • Calcium-activated chloride channel (CaCC) which plays a role in transepithelial anion transport and smooth muscle contraction. Required for the normal functioning of the interstitial cells of Cajal (ICCs) which generate electrical pacemaker activity in gastrointestinal smooth muscles. Acts as a major contributor to basal and stimulated chloride conductance in airway epithelial cells and plays an important role in tracheal cartilage development.

Key References

  • Espinosa I, et. al. Am J Surg Pathol 2008;32:210-218.

Storage & Stability

Antibody with azide - store at 2 to 8°C. Antibody without azide - store at -20 to -80°C. Antibody is stable for 24 months. Non-hazardous. No MSDS required.

Limitations

This antibody is available for research use only and is not approved for use in diagnosis.

Supplied as

200ug/ml of Ab Purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.

Warranty

There are no warranties, expressed or implied, which extend beyond this description. Company is not liable for any personal injury or economic loss resulting from this product.

Reviews

There are no reviews yet.

Be the first to review “DOG-1 / ANO1 (Marker for Gastrointestinal Stromal Tumors) Antibody”

Your email address will not be published. Required fields are marked *

PARTNERSHIP OPPORTUNITIES

We hold Exclusive rights to 10,000 recombinant and hybridoma antibody products, available for Licensing or Collaboration.

LETS TALK