DOG-1 / ANO1 (Marker for Gastrointestinal Stromal Tumors) [DG1/447 + DOG-1.1]

Clear

Summary

Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GIST's), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GIST's, including all c-kit negative GIST's. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GIST's is nearly identical: 94.4% vs. 94.7%.

Product Properties & Targets

Host
Applications
Species Reactivity
Isotype
Cellular Localization
Cell membrane, Cytoplasm
Light Chain
Gene Name
Positive Control
Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
Immunogen
Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).
Alternate Names
Anoctamin-1, Discovered on gastrointestinal stromal tumors protein 1, Oral cancer overexpressed protein 2, Transmembrane protein 16A, Tumor-amplified and overexpressed sequence 2, Anoctamin 1; Calcium Activated Chloride Channel; Discovered On Gastrointestinal Stromal Tumors Protein 1; TAOS2; ORAOV2; TMEM16A

Database Links

Entrez Gene ID
Unigene
SwissProt

Additional Information

Clone
DG1/447 + DOG-1.1
Human Gene Symbol
TMEM16A
Chromosome Location
11q13.3
Mol. Weight of Antigen
~114kDa

Functions

  • Calcium-activated chloride channel (CaCC) which plays a role in transepithelial anion transport and smooth muscle contraction. Required for the normal functioning of the interstitial cells of Cajal (ICCs) which generate electrical pacemaker activity in gastrointestinal smooth muscles. Acts as a major contributor to basal and stimulated chloride conductance in airway epithelial cells and plays an important role in tracheal cartilage development.

Known Applications & Suggested Dilutions

  • Immunohistochemistry (Formalin-fixed) (1-2ug/ml for 30 minutes at RT)(Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 45 min at 95&degC followed by cooling at RT for 20 minutes)
  • Optimal dilution for a specific application should be determined.

Key References

  • Espinosa I, et. al. Am J Surg Pathol 2008;32:210-218.

Storage & Stability

Antibody with azide - store at 2 to 8°C. Antibody without azide - store at -20 to -80°C. Antibody is stable for 24 months. Non-hazardous. No MSDS required.

Limitations

This antibody is available for research use only and is not approved for use in diagnosis.

Supplied as

200ug/ml of Ab Purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.

Warranty

There are no warranties, expressed or implied, which extend beyond this description. Company is not liable for any personal injury or economic loss resulting from this product.

Reviews

There are no reviews yet.

Be the first to review “DOG-1 / ANO1 (Marker for Gastrointestinal Stromal Tumors)”

Your email address will not be published. Required fields are marked *

Recombinant mouse monoclonal antibodies and recombinant rabbit monoclonals to support your research

Shop Primary Antibodies