2 Union Square, Union City, CA 94587
contact@NeoBiotechnologies.com
510-376-5603

Home >> Antibodies >> MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1)

MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1)

Mouse Monoclonal Antibody [Clone 2F6]

Catalog #

Size

20 ug
100 ug
100 ug

Price (USD)

219.00
499.00
499.00

Formulation

Purified Ab with BSA and Azide at 200ug/ml
Purified Ab with BSA and Azide at 200ug/ml
Purified Ab WITHOUT BSA and Azide at 1.0mg/ml

Catalog No

Size

20 ug
100 ug
100 ug

Formulation

Purified Ab with BSA and Azide at 200ug/ml
Purified Ab with BSA and Azide at 200ug/ml
Purified Ab WITHOUT BSA and Azide at 1.0mg/ml

Price (USD)

219.00
499.00
499.00
img

Formalin-fixed, paraffin-embedded human Uterine Carcinoma stained with MAP3K1 Mouse Monoclonal Antibody (2F6).

img

Formalin-fixed, paraffin-embedded human Thyroid Carcinoma stained with MAP3K1 Mouse Monoclonal Antibody (2F6).

img

Formalin-fixed, paraffin-embedded human Cervical Carcinoma stained with MAP3K1 Mouse Monoclonal Antibody (2F6).

Product Details

Synonyms

MEKK1; MEK Kinase 1; MEKK; SRXY6; MAPKKK1

Positive Control

A431, HeLa or HL-60 cells. Liver tissue.

Known Applications & Suggested Dilutions

Western Blot, IHC-P         More Details

Western Blot (1-2ug/ml)
Immunohistochemistry (Formalin-fixed) (1-2ug/ml for 30 minutes at RT)(Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris Buffer with 1mM EDTA, pH 9.0, for 45 min at 95°C followed by cooling at RT for 20 minutes)Optimal dilution for a specific application should be determined.

Immunogen

Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)

Cellular Localization

Cytoplasmic

Species Reactivity

Human.

Host / Ig Isotype

Mouse / IgG2a, kappa

Mol. Weight of Antigen

195kDa (intact); 80kDa (cleaved)

Specificity & Comments

Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.

Related Products



200ug/ml of Ab Purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.

Key References

  1. Guan, K.L. 1994. The mitogen activated protein kinase signal transduction pathway: from the cell surface to the nucleus. Cell. Signal. 6: 581-589.

Bioinformatics

  •  Entrez Gene ID: 4214
  •  Gene Symbol: MAP3K1
  •  SwissProt: Q13233
  •  Chromosome Location: 5q11.2
  •  Unigene: 653654
NBT00316